PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00217g02002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 232aa    MW: 26677.4 Da    PI: 10.1992
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00217g02002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR163.94.7e-2066151290
                      FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                               +Y+eYA ++GF +r+ +s+ks+r+g+i++r + C     ++++    + ++++r   r gC+a++ vk+ek g w+v k++ +Hn
  Niben101Scf00217g02002.1  66 YYDEYAGRAGFITRVLSSRKSERDGSIISRGLGCRGIPDNQRSG---SIANQKRDRRRDGCTAMILVKREKPGMWVVRKFVRDHN 147
                               8*********************************7555555544...4588999999**************************** PP

                      FAR1  87 Hela 90 
                               H+l+
  Niben101Scf00217g02002.1 148 HPLV 151
                               **96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.7E-1866151IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MMTKNLPTEG SLICLFISVD VQISEDNGAR RLETSEIGQV STSEADRTQE PYEGMPFESE  60
EAARAYYDEY AGRAGFITRV LSSRKSERDG SIISRGLGCR GIPDNQRSGS IANQKRDRRR  120
DGCTAMILVK REKPGMWVVR KFVRDHNHPL VISPSKRRPT FDEKDKKIQE LTAELRIKKR  180
LSAAYREQLL SLMKDVDSHR EHMSTKVQAV RRILKELEAK RQELSNHSKH YK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764131.11e-156PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
RefseqXP_009764130.11e-156PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
RefseqXP_009764129.11e-156PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
TrEMBLM1CKJ41e-134M1CKJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000694931e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-45FAR1 family protein